PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma2g02150.1
Common NameZOSMA_2G02150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family HB-other
Protein Properties Length: 149aa    MW: 18015.5 Da    PI: 10.3333
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma2g02150.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.45.7e-1947100356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k ++++ +q++ Lee+F+kn +p++++r+eL kkl+++ rq+k+WFqNrRa+ k
  Zosma2g02150.1  47 KYHRHSLHQIQNLEEVFKKNLHPDQQQRTELGKKLNINSRQIKFWFQNRRAQLK 100
                     5677899********************************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-1835102IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-1840105IPR009057Homeodomain-like
PROSITE profilePS5007116.48742102IPR001356Homeobox domain
SMARTSM003892.2E-1444106IPR001356Homeobox domain
CDDcd000869.21E-1345102No hitNo description
PfamPF000463.2E-1648100IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MMNNGSNLNF FDEKENNFSR GDNFFEAKYD SKQNLEDAMS STDKRIKYHR HSLHQIQNLE  60
EVFKKNLHPD QQQRTELGKK LNINSRQIKF WFQNRRAQLK NQLERYENII LKQENIKLRL  120
EQMSLMNAAR RRPCCFKCRY HIVYGKNL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016564676.11e-35PREDICTED: homeobox-leucine zipper protein ROC5 isoform X1
TrEMBLA0A0K9PDC41e-106A0A0K9PDC4_Z
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP15929915
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.13e-34HD-ZIP family protein